DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC24

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_997223.1 Gene:ZDHHC24 / 254359 HGNCID:27387 Length:284 Species:Homo sapiens


Alignment Length:338 Identity:70/338 - (20%)
Similarity:107/338 - (31%) Gaps:131/338 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PWRGGAKRISPAAVAPAFIVPLMLGLATLNSKTAIVLMLTLVGFTIW----GMELAKRTATRTNF 149
            ||..|:...:||.      :||:|        ||           :|    |:|||         
Human     4 PWAAGSTDGAPAQ------LPLVL--------TA-----------LWAAAVGLELA--------- 34

  Fly   150 FLSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPK 214
                      |::::.....||..||.....||..|           :.|:.|..|.....:.| 
Human    35 ----------YVLVLGPGPPPLGPLARALQLALAAF-----------QLLNLLGNVGLFLRSDP- 77

  Fly   215 DELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRA 279
             .:.|:..|..|..|..|                                  .|..|:...|.|:
Human    78 -SIRGVMLAGRGLGQGWA----------------------------------YCYQCQSQVPPRS 107

  Fly   280 YHCPVCGTCVKRRDHHSYWLNCCIGERNY------VWYIVGLALSEIALLLGANLTLTSICH-PF 337
            .||..|..|:.|||||...|..|:|..||      :.:..|:.| .:::|||..|:.....| |.
Human   108 GHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAGVLL-HVSVLLGPALSALLRAHTPL 171

  Fly   338 MVVRPLGYPVLL----------------PDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQ 386
            .:...|..|.|:                .|.|          ::..:.|.|.|:...:..:..:.
Human   172 HMAALLLLPWLMLLTGRVSLAQFALAFVTDTC----------VAGALLCGAGLLFHGMLLLRGQT 226

  Fly   387 AYLWWKGSTLHEY 399
            .:.|.:|.  |.|
Human   227 TWEWARGQ--HSY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 37/159 (23%)
ZDHHC24NP_997223.1 zf-DHHC 95..234 CDD:279823 35/149 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.