DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and akr1

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_592981.1 Gene:akr1 / 2541757 PomBaseID:SPAC2F7.10 Length:642 Species:Schizosaccharomyces pombe


Alignment Length:328 Identity:63/328 - (19%)
Similarity:104/328 - (31%) Gaps:131/328 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DLVCTRL------VTCRAIDRRNIDGMLIAFQDRLRLPWR----------------GGAKRISPA 100
            :|.|.:|      :.|.|: ..|:.|       :|:.||.                ....::...
pombe   179 NLKCMKLILKEGGIPCTAV-TANLSG-------QLKTPWALASELRVSHLFKQALISNGLKVKET 235

  Fly   101 AVAPA--FIVPLMLGLATLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFFLS----------- 152
            :..|.  .:||...   ..:.||.|:... |..|.|.|:..         |.:|           
pombe   236 SEEPEKWVVVPSKF---QFSQKTFIIFCF-LSSFIITGVFF---------FIMSICPMVISLIIA 287

  Fly   153 --WLVFSVFYM---------IIIFEFQVP-----------------LLELAPEE---------NY 180
              |:.|:..|:         |:.|..:.|                 ||.:.|:.         .:
pombe   288 PLWIYFTFKYITTCIHANIDIVHFYLETPFLAGIFSSIFFWVWCHSLLYIVPKTLPIKPLSSLLF 352

  Fly   181 ALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLD 245
            .|:.|:|..||             |...:      :.||..:......|       :.|.:..|.
pombe   353 VLISFTCIGLY-------------VRTAF------QNPGYVDKIGAVVQ-------RREEISKLL 391

  Fly   246 DDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVW 310
            |.:            :..|.:.|..|.:|.|.|:|||..|..|:.|.|||..|...|:|.||:..
pombe   392 DKD------------LFNQSHYCLKCFQVKPPRSYHCGACKRCINRYDHHCPWTGNCVGARNHRT 444

  Fly   311 YIV 313
            :::
pombe   445 FLL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 20/52 (38%)
akr1NP_592981.1 ANKYR 4..218 CDD:223738 10/46 (22%)
ANK 4..121 CDD:238125
ANK repeat 4..31 CDD:293786
ANK repeat 34..65 CDD:293786
ANK repeat 67..98 CDD:293786
ANK 71..187 CDD:238125 3/7 (43%)
ANK repeat 100..131 CDD:293786
ANK repeat 133..164 CDD:293786
COG5273 311..613 CDD:227598 37/175 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.