DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc5

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_659136.1 Gene:Zdhhc5 / 228136 MGIID:1923573 Length:715 Species:Mus musculus


Alignment Length:249 Identity:65/249 - (26%)
Similarity:89/249 - (35%) Gaps:56/249 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VFSVFYMIIIFEFQVPLLEL-----APEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPK 214
            :|.|....:.|.|..|.|.|     .|..| |:||....|.:.:                 .|..
Mouse    22 IFLVGATTLFFAFTCPGLSLNVSPAVPIYN-AIMFLFVLANFSM-----------------ATFM 68

  Fly   215 DELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRA 279
            |  |||...:..:|..|             ||.......|.|..|: ..:...|..||...|.|.
Mouse    69 D--PGIFPRAEEDEDKE-------------DDFRAPLYKTVEIKGI-QVRMKWCATCRFYRPPRC 117

  Fly   280 YHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLG 344
            .||.||..||:..|||..|:|.|||.|||.::.:.| ||..|.::|.                .|
Mouse   118 SHCSVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFL-LSLTAHIMGV----------------FG 165

  Fly   345 YPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHE 398
            :.:|......|...|....::..|.|.|.|....:|.:......|..:|.|.:|
Mouse   166 FGLLYVLYHIEELSGVRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 40/137 (29%)
Zdhhc5NP_659136.1 zf-DHHC 99..224 CDD:279823 40/139 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..715
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.