DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and dhhc-4

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001023033.1 Gene:dhhc-4 / 191420 WormBaseID:WBGene00014075 Length:405 Species:Caenorhabditis elegans


Alignment Length:341 Identity:73/341 - (21%)
Similarity:119/341 - (34%) Gaps:91/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FIVPLMLGLATLNSKTAIVLMLTLVGFTIWGMELAKRTATRTNFFLSWLVFSVFYMIIIFEFQVP 170
            |:..:::.|||.....|....|.::....|...:              :...:||.::|..:   
 Worm    24 FLPVVLVSLATGWGIYAYTYELCILSIDNWPQRI--------------IYLFIFYALLILFY--- 71

  Fly   171 LLELAPEENYALMFFSCA----ALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAE 231
                   .:|....::.|    ..||:..|.        .|.|.:...||               
 Worm    72 -------TSYLRTVYTKAWKPPQKYCIEGAS--------KATYESVKDDE--------------- 106

  Fly   232 AQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHS 296
                .|::..|| |.....|:....| |..|| ...|:.|..:.|.|::||.:|..||.:.|||.
 Worm   107 ----RQLQLFLS-DIARERDLTLLVR-GFDHG-IRFCDKCCCIKPDRSHHCSMCEQCVLKFDHHC 164

  Fly   297 YWLNCCIGERNYVWYIVGLALSEIALLLGANLTLTSIC----HPFMVVRPLGYPVLLPDDCSEVF 357
            .|:|.|:...||.::|:.||...|..:..|..||.|..    |.:.:.:. .|     |....|.
 Worm   165 PWVNNCVNFGNYKYFILFLAYGFIFCIWIAATTLPSFIDFWRHEYDMNKK-QY-----DSIDSVI 223

  Fly   358 E-------------GFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGR- 408
            :             .|.|.....::|   :.|..::|:.....||..|..|..|..|.....|: 
 Worm   224 QRNLKHLHTVLSNGRFPLVFLLFLSC---MFSLSLSFLFFYHLYLTAKNRTTVESFRAPMIDGKY 285

  Fly   409 ------NRIWSNWRAI 418
                  :.|.:|:|.|
 Worm   286 AKDAFNHGIRANYREI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 40/153 (26%)
dhhc-4NP_001023033.1 zf-DHHC 131..274 CDD:279823 40/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.