DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and dhhc-12

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_492753.2 Gene:dhhc-12 / 186602 WormBaseID:WBGene00010323 Length:310 Species:Caenorhabditis elegans


Alignment Length:206 Identity:39/206 - (18%)
Similarity:63/206 - (30%) Gaps:79/206 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 MLTLVGFTIWGMELAKRTATRTNFFLSWLVFSVFYMIII----------FEFQVPLLELAPEENY 180
            :|.||  .:||..|.......|...::::|  :|.||.:          |.|:..|         
 Worm    30 VLKLV--ALWGGRLCLLIFVGTLCNVTYVV--IFKMIPVEWNECQNMSFFVFRFVL--------- 81

  Fly   181 ALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLD 245
             |::...:.::..|.|:.|:|:    ...| ||.|                              
 Worm    82 -LIYIYYSVVFHYYKARTLTPV----VNPG-TPSD------------------------------ 110

  Fly   246 DDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVW 310
                                :.|..|.........||..|..|:.|.|||...:..|:|..|...
 Worm   111 --------------------SFCIKCNNWKGPSTSHCKACDKCIYRMDHHCPHIGQCVGAHNQSH 155

  Fly   311 YIVGLALSEIA 321
            :.:.|...:||
 Worm   156 FFLFLFYLQIA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 16/60 (27%)
dhhc-12NP_492753.2 zf-DHHC 39..>172 CDD:303066 34/195 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165800
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.