DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and dhhc-9

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001362080.1 Gene:dhhc-9 / 183426 WormBaseID:WBGene00016620 Length:313 Species:Caenorhabditis elegans


Alignment Length:301 Identity:68/301 - (22%)
Similarity:109/301 - (36%) Gaps:101/301 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 FFLSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCL-------YSAKALSPLNLVS 206
            |..::|.|:.|::||.:|   .|.:.|    :.|:......||.|       |.|:.:.|:    
 Worm    48 FISTFLAFTSFFIIIPYE---QLYKPA----WLLLLLGTCGLYFLFNIQYHYYKARTIPPV---- 101

  Fly   207 AQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEIC 271
                            |:.|||                     ||              :.|..|
 Worm   102 ----------------ANPGEE---------------------GD--------------SFCSKC 115

  Fly   272 RKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIG---ERNYVWYIVGLALSEIALLLGA------N 327
            .......|:||.||..||...|||..|:|.|:|   .|::..:|..|.|:...:::..      :
 Worm   116 NYWKSDNAHHCSVCEKCVLGMDHHCIWINQCVGLHNHRHFFLFIANLTLAAATIIIAGYQSFSDH 180

  Fly   328 LTL----TSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYAL--LISSYIAFILARQ 386
            |.|    |:.|...:...||       .|....::||  ..:.||.||.|  ::...:..:.:..
 Worm   181 LFLESSQTTYCTTILEHAPL-------QDIICDYDGF--ARTSVVFCYLLSGILLVMVGGLTSWN 236

  Fly   387 AYLWWKGSTLHEYKRTS----NAAGRNRI----WSNWRAIL 419
            .||...|.|..:|.:.:    |.:.|.|:    .:|||..|
 Worm   237 IYLISIGCTYIDYLKLTGSKKNTSARKRLNKGFKANWRNFL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/151 (25%)
dhhc-9NP_001362080.1 DHHC 106..251 CDD:366691 43/188 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165799
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.