DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and ZDHHC19

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:260 Identity:66/260 - (25%)
Similarity:94/260 - (36%) Gaps:78/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LVFSVFYMIIIFEFQVPLLELAPEENYA----------LMFFSCAALYCLYSAKALSPLNLVSAQ 208
            :|..||:..:.|.|  |...||....:|          |.|||                 |||..
Human    35 VVLLVFFSGLFFAF--PCRWLAQNGEWAFPVITGSLFVLTFFS-----------------LVSLN 80

  Fly   209 YGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNI--CEIC 271
            :..      |||....|.|:                     |.: |.....:.||...:  |..|
Human    81 FSD------PGILHQGSAEQ---------------------GPL-TVHVVWVNHGAFRLQWCPKC 117

  Fly   272 RKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWY---IVGLALSEIALLLGANLTLTSI 333
            ....|.|.||||.|..||:..|||..|:|.|||.||:.::   ::.|.|...|:|:...:.|...
Human   118 CFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRT 182

  Fly   334 CH-PFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILARQAYLWWKGSTLH 397
            .| ||...:.:...|.:.      ..|..:.:|.::...||.:||      |.:.|   ||...|
Human   183 THLPFSTDKAIAIVVAVS------AAGLLVPLSLLLLIQALSVSS------ADRTY---KGKCRH 232

  Fly   398  397
            Human   233  232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 43/142 (30%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 26/71 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.