DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc15

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_011245807.1 Gene:Zdhhc15 / 108672 MGIID:1915336 Length:355 Species:Mus musculus


Alignment Length:279 Identity:66/279 - (23%)
Similarity:106/279 - (37%) Gaps:68/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WGMELA--KRTATRTNFFLSWLVFSVFYMIIIFEFQVPLLE------LAPEEN--YALMFFSCAA 189
            |.|.|:  .|...|.   |||:...|..:::::.:...:.|      |:|.|.  |.:::.:...
Mouse     5 WKMALSGGLRCCRRV---LSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFV 66

  Fly   190 LYCLYSAKALSPL-NLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMD 253
            .:.....|::..| ...:.::..:..|:     |....||:.|.|..:.:        |....:.
Mouse    67 FFAWTYWKSIFTLPQQPNQKFHLSYTDK-----ERYKNEERPEVQKQMLV--------DMAKKLP 118

  Fly   254 TAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLALS 318
            ...|:|  .|....|:.|..:.|.|.:||.||..||.:.|||..|:|.|||..||.:::..||.|
Mouse   119 VYTRTG--SGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYS 181

  Fly   319 EIALLLGANLT-----------LTSICHPFMVVRPL--------------GY--------PVLLP 350
            .:..|..|...           |.|:...|.|:..|              ||        ...|.
Mouse   182 VLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLE 246

  Fly   351 DDCSEVF------EGFDLG 363
            ..|:.||      .||:||
Mouse   247 AFCTPVFTSGPEKNGFNLG 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/141 (29%)
Zdhhc15XP_011245807.1 DHHC <126..308 CDD:388695 41/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.