DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and Zdhhc7

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_598728.1 Gene:Zdhhc7 / 102193 MGIID:2142662 Length:308 Species:Mus musculus


Alignment Length:281 Identity:62/281 - (22%)
Similarity:115/281 - (40%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFSVFYMIIIFEFQVPLLELAPEEN--YAL---MFFSCAALYCLYSAKALSPLNLVSAQYG 210
            ::||      :::..:|.|..:.|.|.::  |::   :.|:|.|:..|     .|.|..:....|
Mouse    53 MTWL------LVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLAL-----SSHLRTMLTDPG 106

  Fly   211 TTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVT 275
            ..||           |....|...:||::.         |:        :::..|..|  |  :.
Mouse   107 AVPK-----------GNATKEYMESLQLKP---------GE--------VIYKCPKCC--C--IK 139

  Fly   276 PRRAYHCPVCGTCVKRRDHHSYWLNCCIGERN---YVWYIVGLALSEIALLLGANLTLTSICHPF 337
            |.||:||.:|..|:::.|||..|:|.|:||:|   :|.:.:.:|||.:..|:...|...| |   
Mouse   140 PERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGLQFIS-C--- 200

  Fly   338 MVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACY----ALLISSYIAFILARQAYLWWKGSTLHE 398
              ||...      .:||:    |...|:.::..:    .||..::.|.:...|.:......|..|
Mouse   201 --VRGQW------TECSD----FSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIE 253

  Fly   399 YKRTSNAAGRNRI-WSNWRAI 418
            ..::.......|: |...:::
Mouse   254 RLKSEKPTWERRLRWEGMKSV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/143 (27%)
Zdhhc7NP_598728.1 DHHC 131..258 CDD:366691 39/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.