DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc1

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_002937368.1 Gene:zdhhc1 / 100490202 XenbaseID:XB-GENE-989930 Length:562 Species:Xenopus tropicalis


Alignment Length:296 Identity:63/296 - (21%)
Similarity:101/296 - (34%) Gaps:91/296 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 WGMELAKRTATRTNFFLSWLVFSVFYMIIIFEFQVPLLELAPEENYALMFFSCAAL----YCL-- 193
            |.:.|.:        .::|..| :|:.||.|...||||    .:::....:.|..:    :|:  
 Frog    35 WPLHLLQ--------LVAWCTF-LFFAIIGFGILVPLL----PQHWLAAGYICTGVMFTFHCVVH 86

  Fly   194 YSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEV------GDM 252
            :.|..:.|.                                           ||.|      |.:
 Frog    87 FLAVTIDPA-------------------------------------------DDNVQAKGSHGPL 108

  Fly   253 DTAERSGLMHGQPNI-CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGLA 316
            ...:.:...|...|: |.||......::.||.:|..||...|||..|||.|:||:|| |......
 Frog   109 PVFDHNKHAHVIENMHCYICEVDVGPKSKHCSICNKCVSNFDHHCKWLNNCVGEKNY-WLFFNCL 172

  Fly   317 LSEIALLLGANLTLTSICHPFM----------------VVRPLG--YPVLLPDDCSEVFEGFDLG 363
            :|   ..||..|..|...:.|:                .::.|.  :.|.||....|......|.
 Frog   173 IS---AFLGTFLLSTISTYVFVEYFVDPAMLRTSQQFEAIQNLSDVWFVFLPSAPVETKAPAILA 234

  Fly   364 ISFVVACYALLISSYIAFILARQAYLWWKGSTLHEY 399
            ::.:|:...|:....|..:|....||.|...:.:||
 Frog   235 LAAIVSVMGLITILLIGQLLCFHVYLLWNKLSTYEY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 41/155 (26%)
zdhhc1XP_002937368.1 SBF 35..>78 CDD:388533 13/55 (24%)
DHHC 124..274 CDD:366691 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.