DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc14

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:XP_004914695.1 Gene:zdhhc14 / 100489334 XenbaseID:XB-GENE-998053 Length:481 Species:Xenopus tropicalis


Alignment Length:313 Identity:74/313 - (23%)
Similarity:115/313 - (36%) Gaps:91/313 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 KRTAT----------RTNFFLSWLVF-----SVFYMIIIFEFQVPLLELAPEENYALMFFSCAAL 190
            |:.||          |..|:....|.     .|||:.:|       |.|....    :||   |.
 Frog    23 KKKATVRRKWEVFPGRNKFYCDGRVMMARQTGVFYLTLI-------LILVTSG----LFF---AF 73

  Fly   191 YCLYSAKALSPL------NLVSAQYGTTPKDEL--PGIAEASSGEEQAEAQTTLQMESVLSLDDD 247
            .|.|.|..::|.      .||....||..:...  ||:...::.:|.|:.:..:           
 Frog    74 DCPYLAVKITPAIPVIGGILVFFVMGTLLRTSFSDPGVLPRATPDEAADLERQI----------- 127

  Fly   248 EVGDMDTAERSG-----------LMHGQP---NICEICRKVTPRRAYHCPVCGTCVKRRDHHSYW 298
               |:.....||           :::||.   ..|..|:...|.||.||.:|..||:|.|||..|
 Frog   128 ---DVANGSTSGGYRPPPRTKEVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVERFDHHCPW 189

  Fly   299 LNCCIGERNY-VWYIVGLALSEIALLLGANLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDL 362
            :..|:|:||| .:|:..|:||.:.:.:.|.:    |.|..:..:..|:...|.|..:.|.|    
 Frog   190 VGNCVGKRNYRFFYMFILSLSFLTVFIFAFV----ITHVILRSQQSGFLNALKDSPASVLE---- 246

  Fly   363 GISFVVACYALLISSYIAFILARQAYLWWKGSTLHEYKRTSNAAGRNRIWSNW 415
                .|.|: ..:.|.:..            |..|.|..:||......|..:|
 Frog   247 ----AVVCF-FSVWSIVGL------------SGFHTYLISSNQTTNEDIKGSW 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 39/140 (28%)
zdhhc14XP_004914695.1 DHHC 156..279 CDD:366691 40/147 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.