DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc21

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001116527.1 Gene:zdhhc21 / 100144560 ZFINID:ZDB-GENE-080401-2 Length:263 Species:Danio rerio


Alignment Length:180 Identity:52/180 - (28%)
Similarity:75/180 - (41%) Gaps:45/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LSWLVFS-VFYMIIIFEFQVPLLELAPEENYALMFFSCAALYCLYSAKALSPLNLVSAQYGTTPK 214
            :.|...| ||::.|...|.:|.|.|.|  :||....:...:.|.|    |:.|...||.:..:..
Zfish    12 MGWFCMSMVFFVWIYNSFLIPKLVLLP--HYAEGHITAEPVICYY----LASLLCFSALFRASTT 70

  Fly   215 DELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRA 279
            |  ||               .|..:..:.|          |||...     .:|..|..:.|:|:
Zfish    71 D--PG---------------KLAQDPKIPL----------AERDNW-----ELCNKCNMMRPKRS 103

  Fly   280 YHCPVCGTCVKRRDHHSYWLNCCIGERNYVWYIVGL-----ALSEIALLL 324
            :||..||.||:|.|||..|:|.|:||.|: |..:.|     .||...|:|
Zfish   104 HHCSRCGHCVRRMDHHCPWINNCVGEDNH-WLFLQLCFYTQVLSFYTLVL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 26/68 (38%)
zdhhc21NP_001116527.1 zf-DHHC 87..217 CDD:279823 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D519878at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.