DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABPI and zdhhc9

DIOPT Version :9

Sequence 1:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001096162.1 Gene:zdhhc9 / 100124706 XenbaseID:XB-GENE-1016830 Length:365 Species:Xenopus tropicalis


Alignment Length:292 Identity:63/292 - (21%)
Similarity:110/292 - (37%) Gaps:96/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VFYMIIIFEFQVPLLELAPEENYALMFFSCA---ALYCLYSAKALSP----------LNLVSAQY 209
            :||:.:|                 |:..:|:   |..|.|.|..|||          |..::...
 Frog    37 IFYLTLI-----------------LILGTCSLFFAFECRYLAVHLSPAIPVFAAVLFLFAMATLL 84

  Fly   210 GTTPKDELPGIAEASSGEEQAEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNI------- 267
            .|:..|  ||:...:..:|.|..:..::..:         |::...:|.     .|.|       
 Frog    85 RTSFSD--PGVIPRALPDEAAFIEMEIEAAN---------GNVPQGQRP-----PPRIKNVQINN 133

  Fly   268 -------CEICRKVTPRRAYHCPVCGTCVKRRDHHSYWLNCCIGERNY-VWYIVGLALSEIALLL 324
                   |..|:...|.||.||.:|..||:|.|||..|:..|:|:||| .:|:..|:||.:.:.:
 Frog   134 QIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYI 198

  Fly   325 GA----NLTLTSICHPFMVVRPLGYPVLLPDDCSEVFEGFDLGISFVVACYALLISSYIAFILAR 385
            .|    .:.|.|:        .:|:...|.:....|.|.|   |.|......:.::.:..|::: 
 Frog   199 FAFNIVYVALNSL--------SIGFLNTLKESPGTVLEVF---ICFFTLWSVVGLTGFHTFLVS- 251

  Fly   386 QAYLWWKGSTLHEYKRTSNA------AGRNRI 411
                         ..:|:|.      .|:||:
 Frog   252 -------------LNQTTNEDIKGSWTGKNRV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 37/155 (24%)
zdhhc9NP_001096162.1 DHHC 138..261 CDD:366691 37/147 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.