DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17219 and NNT1

DIOPT Version :9

Sequence 1:NP_608740.2 Gene:CG17219 / 33515 FlyBaseID:FBgn0031494 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_013387.1 Gene:NNT1 / 850991 SGDID:S000004275 Length:261 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:48/194 - (24%)
Similarity:85/194 - (43%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EQSHLVNLDLRKSEENHSDL--ISGVYEGGAKIWECTEDLL----LYLSEKYED--SFWKEKRVL 146
            ::||:       ::|:.||:  |.....|.:.:|   ..||    :|.:...:.  ...|.|.||
Yeast    33 QRSHI-------TKESKSDVKDIKLRLVGTSPLW---GHLLWNAGIYTANHLDSHPELIKGKTVL 87

  Fly   147 DLGCGCGLLGIYAMKHGARV----DFQDYNKDVLEYITYPNILLNLDDSLSEDEKLKFLDNSTT- 206
            :||....|..:....:||::    |:.|  .|:::.|.|     |:..::.||     .:|.:| 
Yeast    88 ELGAAAALPSVICALNGAQMVVSTDYPD--PDLMQNIDY-----NIKSNVPED-----FNNVSTE 140

  Fly   207 --LYSGDWS----HFAELSRDVAKYDLILTSETIYNIANQQKLLDTFAGRLKSDGVILVAAKSH 264
              ::..|:|    |..::..:..|:|||:.|:.::|.....|||.|....|...|..||....|
Yeast   141 GYIWGNDYSPLLAHIEKIGNNNGKFDLIILSDLVFNHTEHHKLLQTTKDLLAEKGQALVVFSPH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17219NP_608740.2 Methyltransf_18 141..261 CDD:289607 36/130 (28%)
NNT1NP_013387.1 Nnt1 1..256 CDD:226413 48/194 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3897
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.