DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17219 and CG5013

DIOPT Version :9

Sequence 1:NP_608740.2 Gene:CG17219 / 33515 FlyBaseID:FBgn0031494 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_650520.1 Gene:CG5013 / 41951 FlyBaseID:FBgn0038396 Length:247 Species:Drosophila melanogaster


Alignment Length:215 Identity:54/215 - (25%)
Similarity:75/215 - (34%) Gaps:78/215 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 DLISGVYEGGAKIWECTEDLLLYLSEKYEDSFWKEKRVLDLGCGCGLLGIYAMKHGARVDFQD-- 170
            :|:.|.|  ....|.|...|..:|.|:.:.  ...||:|:||.|..|.||.|.|..|:|...|  
  Fly    43 ELLQGAY--SFYTWPCAPILAHFLWERRQT--LAGKRILELGSGTALPGILAAKCRAQVVLTDNC 103

  Fly   171 --------YNKDVLEYITYPNI-----------LLN-----------------LDDSLSED--EK 197
                    ..|..|.....|.:           |||                 .|.|:.||  ..
  Fly   104 ILPKSLAHIRKSCLANQLQPGVDIDVVGLSWGLLLNSVFRLPPLDLIIAADCFYDPSVFEDIVVT 168

  Fly   198 LKFL--DNSTTLY-------SGDWSHFAELSR-----------DVAK---YDLI--LTSETIYNI 237
            :.||  .|:...:       |.|||..|.|.:           |:.|   .||:  :...||:  
  Fly   169 VAFLLERNAGAKFIFTYQERSADWSIEALLKKWKLQALPISMEDIGKESGVDLLEFMGGHTIH-- 231

  Fly   238 ANQQKLLDTFAGRLKSDGVI 257
                 ||:  ..|::|||.|
  Fly   232 -----LLE--ITRIESDGSI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17219NP_608740.2 Methyltransf_18 141..261 CDD:289607 46/182 (25%)
CG5013NP_650520.1 AdoMet_MTases 54..201 CDD:302624 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14614
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.