DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17219 and C37A2.6

DIOPT Version :9

Sequence 1:NP_608740.2 Gene:CG17219 / 33515 FlyBaseID:FBgn0031494 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_491943.2 Gene:C37A2.6 / 183284 WormBaseID:WBGene00016492 Length:244 Species:Caenorhabditis elegans


Alignment Length:173 Identity:38/173 - (21%)
Similarity:69/173 - (39%) Gaps:34/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IWECTEDLLLYLSEKYEDSFW-----------------KEKRVLDLGCGCGLLGIYAMKHGA-RV 166
            :|..|.| ...|.:.|...:|                 :...::|.|.|||...|.|...|| ::
 Worm    39 LWMSTPD-ACPLPDPYWAFYWPGGQGLSRFILDNKPLFQGSEIVDFGAGCGSASISASICGAKKI 102

  Fly   167 DFQDYNKDVLEYITYPNILLNLDDSLSEDEKLKFLDNSTTLYSGDWSHFAELSRDVAKYDLILTS 231
            ...|.::..|........|.||.||..:...:.|||:.....|   :.|...|:::.|:  ||..
 Worm   103 LANDIDRYALLSTKLNFHLNNLRDSKIQYSSINFLDDKNERMS---TQFFTDSKNIRKF--ILLG 162

  Fly   232 ETIYNIANQQKLLDTFAGRLKSDGVILV---------AAKSHY 265
            :..|: ::..:||.::..:::...::.|         .|:|.|
 Worm   163 DMFYD-SDFAELLFSWLKKIQDAHMVRVLVGDPDRHPLAESEY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17219NP_608740.2 Methyltransf_18 141..261 CDD:289607 29/129 (22%)
C37A2.6NP_491943.2 Nnt1 18..210 CDD:226413 38/173 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3897
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.