DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17219 and etfbkmt

DIOPT Version :9

Sequence 1:NP_608740.2 Gene:CG17219 / 33515 FlyBaseID:FBgn0031494 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001154967.1 Gene:etfbkmt / 100005455 ZFINID:ZDB-GENE-111107-1 Length:258 Species:Danio rerio


Alignment Length:122 Identity:34/122 - (27%)
Similarity:42/122 - (34%) Gaps:28/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WECTEDLLLYLSEKYEDSFWKEKRVLDLGCGCGLLGIYAMKHGARVDFQDYNKDVLEYITYPNIL 185
            |...:.|..||....|.|  ..::|||||||||...|.|...||.....:....:....|..|..
Zfish    89 WPGGQALARYLLNNPEVS--AGRKVLDLGCGCGASAIAARLSGASCVVANDIDPIAAIATKMNCE 151

  Fly   186 LNLDDSLSEDEKLKFL----DNSTTLYSGDWSHFAELSRDVAKYDLILTSETIYNIA 238
            ||         .|..|    ||.....:..|             ||||..:..|:.|
Zfish   152 LN---------NLAPLPCVTDNMIGSETDGW-------------DLILLGDMFYDEA 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17219NP_608740.2 Methyltransf_18 141..261 CDD:289607 28/102 (27%)
etfbkmtNP_001154967.1 Nnt1 38..252 CDD:226413 34/122 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3897
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.