Sequence 1: | NP_608738.1 | Gene: | CG3542 / 33513 | FlyBaseID: | FBgn0031492 | Length: | 806 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057712.2 | Gene: | WAC / 51322 | HGNCID: | 17327 | Length: | 647 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 45/197 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 TSTEWTEHKAPDGRPYYYNQNTKQSSWEKPEALMTPAELLHNQCPWKEYRSDTGKVYYHNVATKE 116
Fly 117 TCWEPPPEYVDMKAKAKAEEAAAAAKAVAAMTSSSLAGMVPPAAL-------------------A 162
Fly 163 SILPAALPVAP-----RLPTPEIHSPLTPSSNENSSSAMDQAMAATLAAIEVPQQN--AKKDDKS 220
Fly 221 ES 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3542 | NP_608738.1 | PRP40 | 54..634 | CDD:227435 | 45/195 (23%) |
WW | 54..81 | CDD:278809 | 12/26 (46%) | ||
WW | 95..122 | CDD:278809 | 4/26 (15%) | ||
FF | 231..280 | CDD:280090 | |||
FF | 445..500 | CDD:280090 | |||
WAC | NP_057712.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..138 | 1/6 (17%) | |
WW | 133..160 | CDD:278809 | 12/26 (46%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 168..353 | 29/154 (19%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 428..549 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5104 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |