DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3542 and waca

DIOPT Version :9

Sequence 1:NP_608738.1 Gene:CG3542 / 33513 FlyBaseID:FBgn0031492 Length:806 Species:Drosophila melanogaster
Sequence 2:NP_955954.1 Gene:waca / 323904 ZFINID:ZDB-GENE-030131-2624 Length:558 Species:Danio rerio


Alignment Length:175 Identity:43/175 - (24%)
Similarity:76/175 - (43%) Gaps:38/175 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EWTEHKAPDGRPYYYNQNTKQSSWEKP-----------EALMTPAELLHNQCPW-KEYRSDTGKV 107
            :|:||.:..|:.||||..|:.|.||||           ||..|.|.:  |..|. ::||      
Zfish   125 DWSEHISSSGKKYYYNCRTEVSQWEKPKEWLEREQRQKEATKTAAVV--NSFPKDRDYR------ 181

  Fly   108 YYHNVATKETCWEPPPEYVDMKAKAKAEEAAAAAKAVAAMTSSSLAGMVPPAALASILPAALPVA 172
                   :|.....|..|...|:....|:.::   ...:.:|::::|:..|.:.:|...:.:||:
Zfish   182 -------REAMQATPASYSSTKSSIATEKPSS---LTPSSSSAAVSGLDVPNSASSASGSTVPVS 236

  Fly   173 PRLPTPEIHSPLTPSSNENSSSAMDQAMAATLAAIEVPQQNAKKD 217
            |.:.:|      .|.:.....|.:.|.:.|...|:::  .||..|
Zfish   237 PVMQSP------APPTLLQDPSLLRQLLLALQTALQL--NNASVD 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3542NP_608738.1 PRP40 54..634 CDD:227435 43/175 (25%)
WW 54..81 CDD:278809 12/25 (48%)
WW 95..122 CDD:278809 4/27 (15%)
FF 231..280 CDD:280090
FF 445..500 CDD:280090
wacaNP_955954.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129 1/3 (33%)
WW 124..151 CDD:278809 12/25 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..244 21/108 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5104
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.