DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and AT5G01250

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_195745.1 Gene:AT5G01250 / 831833 AraportID:AT5G01250 Length:407 Species:Arabidopsis thaliana


Alignment Length:281 Identity:78/281 - (27%)
Similarity:121/281 - (43%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RQACAIESAAMHNPNFQVFVLFAGPTYRISNNKSHPQ------PLLE---AILSYSNVHLRRLNL 154
            |:..||||....:|...:.:|        |.....||      |.::   .:|:.:.      :|
plant   141 REVLAIESVFKSHPYGCLMIL--------SATMDSPQGYATLKPFIDRGYKVLAVTP------DL 191

  Fly   155 ESYASGTPMEEWL---KDGRLSRSKY-LFSHISDFLRYLTLYRYGGLYLDMDVVVLRNMEKVPPN 215
            .....||..|.||   |.|:....|. |..::|:.:|...||:|||:|||.|::||::.:.: .|
plant   192 PFLLKGTAGELWLDEIKSGKRDPGKISLAQNLSNLMRLAYLYKYGGVYLDTDMIVLKSFKGL-RN 255

  Fly   216 YTGAE----SNTHLAAGVMNLAATGF--GHEIAASCLRDFQHNFNGGDWGNNGPGVITRVAQKIC 274
            ..||:    |:|:...  :|.|...|  .|.:....:.:|...|||..||.|||.:::|||:.:.
plant   256 VIGAQTLDPSSTNWTR--LNNAVLIFDKNHPLLLKFMEEFAKTFNGNIWGYNGPYLVSRVARAVE 318

  Fly   275 GTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEETIARCKDS------------ 327
            |:..           ..|.|.....||:|.|.:.:..|:....|      |||            
plant   319 GSSG-----------YNFTVMRPSVFYSVNWLEIKKLFKVPKTE------KDSKWVKTKLLHMQR 366

  Fly   328 --YVVHVWNKHSSKLPIKIGS 346
              |.:|:|||.|.|..|:.||
plant   367 NGYGLHLWNKFSRKYEIEQGS 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 36/130 (28%)
Gb3_synth 239..365 CDD:282437 35/122 (29%)
AT5G01250NP_195745.1 Gly_transf_sug 139..261 CDD:309577 38/134 (28%)
Gb3_synth 283..400 CDD:309631 35/122 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3714
eggNOG 1 0.900 - - E1_KOG1928
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2118
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm1048
orthoMCL 1 0.900 - - OOG6_104694
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.