DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and AT4G19900

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_193724.2 Gene:AT4G19900 / 827735 AraportID:AT4G19900 Length:644 Species:Arabidopsis thaliana


Alignment Length:312 Identity:68/312 - (21%)
Similarity:127/312 - (40%) Gaps:62/312 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 FFHETSCRL---------------SENRQLETLKVTARQACAIESAAMHNPNFQVFVLFAGPTYR 126
            ||.:..|.:               ...|.||:|....|.||.:..:.....:|     |.....:
plant   362 FFRKEKCSMRVFMVWNSPGWMFSVRHQRGLESLLSQHRDACVVVFSETVELDF-----FRNSFVK 421

  Fly   127 ISNNKSHPQPLLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGRLSRSKYLFSHISDFLRYLTL 191
            .|...:...|.|:.:|..:..|:       :||     .|. |.|  ::|:..:|.|:.:|...|
plant   422 DSYKVAVAMPNLDELLQDTPTHV-------FAS-----VWF-DWR--KTKFYPTHYSELVRLAAL 471

  Fly   192 YRYGGLYLDMDVVVLRNMEKVPPNYTGAESNTHLAAGVMNLAATGFGHE--IAASCLRDFQHNFN 254
            |:|||:|||.||:||.::..: .|..|.|.  .:|...:|.|...|..:  ....||.::...::
plant   472 YKYGGVYLDSDVIVLGSLSSL-RNTIGMED--QVAGESLNGAVMSFEKKSPFLLECLNEYYLTYD 533

  Fly   255 GGDWGNNGPGVITRVAQKICGTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEE 319
            ......||..::||||::....|:..:.:::      ..:.....|:.:..:|..::|....:|:
plant   534 DKCLRCNGADLLTRVAKRFLNGKNRRMNQQE------LNIRPSSVFFPINSQQITNYFAYPAIED 592

  Fly   320 TIARCKDSY--------VVHVWNKHSSKL---PIKIGSKNAYALYAEQNCPR 360
            ..::..:|:        ..|.||..:|.|   |     ::..|.:.:.:|.|
plant   593 ERSQQDESFKKILNESLTFHFWNSVTSSLIPEP-----ESLVAKFLDHSCIR 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 32/117 (27%)
Gb3_synth 239..365 CDD:282437 23/135 (17%)
AT4G19900NP_193724.2 Gly_transf_sug 384..503 CDD:282357 38/141 (27%)
Gb3_synth 518..644 CDD:282437 23/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1928
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm1048
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.