DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and AT3G09020

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_187514.1 Gene:AT3G09020 / 820054 AraportID:AT3G09020 Length:411 Species:Arabidopsis thaliana


Alignment Length:206 Identity:61/206 - (29%)
Similarity:97/206 - (47%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TPMEEWLKD--------GRLSRSKYLFSHISDFLRYLTLYRYGGLYLDMDVVVLRNMEKVPPNYT 217
            |..|.||::        |::|    |..::|:.:|...|:::||:|||.|::||::. |...|..
plant   202 TAGESWLEEIQTGKRDPGKIS----LAQNLSNLMRLAYLFKFGGVYLDTDMIVLKSF-KTLRNVI 261

  Fly   218 GAESNTHLAAG--VMNLAATGF--GHEIAASCLRDFQHNFNGGDWGNNGPGVITRVAQKICGTKD 278
            ||::...::..  .:|.|...|  .|......:.:|...|||..||:|||.:::|||:.:.||..
plant   262 GAQTLEPVSRNWTRLNNAVLIFDKNHPFLLKSIEEFALTFNGNVWGHNGPYLVSRVARAVEGTDG 326

  Fly   279 IALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEETIARC--------KDSYVVHVWNK 335
                       ..|.:....|||.|.|.:....|:....|:...|.        |.||.:|:|||
plant   327 -----------YNFTILTPPAFYPVNWVEIEKLFKVPRTEKDSKRVQVKVLEMQKRSYGLHLWNK 380

  Fly   336 HSSKLPIKIGS 346
            .|.|..|:.||
plant   381 FSRKFEIEQGS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 20/63 (32%)
Gb3_synth 239..365 CDD:282437 36/116 (31%)
AT3G09020NP_187514.1 Gly_transf_sug 143..265 CDD:398274 22/67 (33%)
Gb3_synth 287..404 CDD:398326 36/116 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3714
eggNOG 1 0.900 - - E1_KOG1928
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2118
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm1048
orthoMCL 1 0.900 - - OOG6_104694
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X281
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.