DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and A4gnt

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_008764810.2 Gene:A4gnt / 685758 RGDID:1590210 Length:342 Species:Rattus norvegicus


Alignment Length:361 Identity:101/361 - (27%)
Similarity:165/361 - (45%) Gaps:62/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LVLMVIGGLFYIYTSENKYHSCFMEGQVLATQQALTA-DGETNLLGDVLQADPKPSPGNSIFFHE 80
            |||:...||.|..|..::   ||     .|.....|: .|...||.:          |.||.|.|
  Rat    11 LVLVFACGLLYQLTLRSQ---CF-----FACLPPFTSPQGLEGLLRN----------GRSIVFIE 57

  Fly    81 TSCRLSENRQLETLKVTARQACAIESAA---MHNPNFQVFVLF-----AGPTYRISNNKSHPQ-P 136
            ||         |.|:.....:||:||||   ...|     :||     :..|...||..|:|. .
  Rat    58 TS---------ERLEPPPLVSCAVESAAKIYQEQP-----ILFFMKGLSNATQMTSNTSSYPAFS 108

  Fly   137 LLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGRLSRSKYLFSHISDFLRYLTLYRYGGLYLDM 201
            ||.||   :||....|::::....||:..|......||.|:.....||..|...:::|||:|:|.
  Rat   109 LLSAI---NNVFFVPLDMKTLFEDTPLFSWYTKVNSSREKHWLHVSSDASRLAIIWKYGGVYMDT 170

  Fly   202 DVVVLRNMEKVPPNYTGAESNTHLAAGVMNLAATGF--GHEIAASCLRDFQHNFNGGDWGNNGPG 264
            ||:.:|.:.:  .|:..|:.:.|.:.||.     ||  .|....:|:.:|..::|.|.|||.||.
  Rat   171 DVISIRPIPE--ENFLAAQGSQHSSNGVF-----GFLPHHPFLWACMENFVEHYNSGIWGNQGPK 228

  Fly   265 VITRVAQKICGTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEETIARCKDSYV 329
            ::||:.:..|..||...:.:  .:|:.........||.:|:.:||.:::..:.:.:.   .|||.
  Rat   229 LMTRMLKIWCRLKDFQGLGD--LKCLNISFLHPQRFYPIPYPEWRRYYQVWDRDLSF---NDSYA 288

  Fly   330 VHVWN--KHSSKLPIKIGSKNAYALYAEQNCPRSYK 363
            :|:||  ....|..:: ||.:......:::||::|:
  Rat   289 LHLWNFMNREGKTVVR-GSNSLVENLYQKHCPKTYR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 39/126 (31%)
Gb3_synth 239..365 CDD:282437 33/127 (26%)
A4gntXP_008764810.2 Gly_transf_sug 65..184 CDD:418730 39/128 (30%)
Gb3_synth 203..325 CDD:398326 33/127 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9678
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I4247
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm8928
orthoMCL 1 0.900 - - OOG6_104694
Panther 1 1.100 - - LDO PTHR12042
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X281
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.980

Return to query results.
Submit another query.