powered by:
Protein Alignment alpha4GT1 and C01G5.7
DIOPT Version :9
Sequence 1: | NP_608737.1 |
Gene: | alpha4GT1 / 33512 |
FlyBaseID: | FBgn0031491 |
Length: | 369 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001293705.1 |
Gene: | C01G5.7 / 182075 |
WormBaseID: | WBGene00015309 |
Length: | 156 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 9/38 - (23%) |
Similarity: | 15/38 - (39%) |
Gaps: | 8/38 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 NKYHSCFMEGQVLATQQALTADGETNLLGDVLQADPKP 70
|..:.|...|::...:..||:..| :..|||
Worm 120 NDKYKCADCGKIFLNENFLTSHFE--------RRHPKP 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160164005 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.