DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and dzpr-1

DIOPT Version :10

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001293705.1 Gene:dzpr-1 / 182075 WormBaseID:WBGene00015309 Length:156 Species:Caenorhabditis elegans


Alignment Length:38 Identity:9/38 - (23%)
Similarity:15/38 - (39%) Gaps:8/38 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NKYHSCFMEGQVLATQQALTADGETNLLGDVLQADPKP 70
            |..:.|...|::...:..||:..|        :..|||
 Worm   120 NDKYKCADCGKIFLNENFLTSHFE--------RRHPKP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:398274
Gb3_synth 234..365 CDD:428017
dzpr-1NP_001293705.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.