DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC101733902

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_031758608.1 Gene:LOC101733902 / 101733902 -ID:- Length:197 Species:Xenopus tropicalis


Alignment Length:189 Identity:52/189 - (27%)
Similarity:92/189 - (48%) Gaps:14/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 FSHIS-DFLRYLTLYRYGGLYLDMDVVVLRNMEKVPPNYTGAESNTHLAAGVMNLAATGFGHEIA 242
            ::|:| |..|...::::||:|:|.|::.:|.:..|  |:..|:.:...:.||..|:   ..|..:
 Frog    11 WTHVSADGCRLALVWKHGGIYMDSDIISMRPIPDV--N
FLAAQYSQSSSNGVFGLS---HHHNFS 70

  Fly   243 ASCLRDFQHNFNGGDWGNNGPGVITRVAQKICGTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQ 307
            ...:.:|..|:||..|||.||.:.||..:..|...... ..||.| |..........||.:|::.
 Frog    71 WKSMENFVQNYNGAIWGNQGPQLFTRTLKTFCTIPQFK-SNEDVK-CGNISFLNPKRFYPIPYEA 133

  Fly   308 WRDFFEPENLEETIARCKDSYVVHVWNKHSSKLPIKIGSKNAYA--LYAEQNCPRSYKA 364
            |:.:::   :...:....|||.:|:||..:.:....:..||...  || :|.||.:|.|
 Frog   134 WKRYYD---VWPNVPTFNDSYALHLWNFMNKEQKTMVPGKNTLIEHLY-KQYCPTTYSA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 12/38 (32%)
Gb3_synth 239..365 CDD:282437 36/128 (28%)
LOC101733902XP_031758608.1 Gly_transf_sug <3..46 CDD:418730 11/36 (31%)
Gb3_synth 67..189 CDD:398326 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.