DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC101733668

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_004915066.1 Gene:LOC101733668 / 101733668 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:372 Identity:99/372 - (26%)
Similarity:157/372 - (42%) Gaps:62/372 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AVARRMFIILVLMVIGGLFYIYTSENKYHSCFMEGQVLATQQALTADGETNLLGDVLQADPKPSP 72
            |:.|...::.:.|..|.|:.|:..:...|  |......|...........|:|.|          
 Frog     4 ALGRFALLMFMFMTCGFLYRIFNVQPFAH--FQWPLPPAPPSFSPISPAQNVLRD---------- 56

  Fly    73 GNSIFFHETSCRLSENRQLETLKVTARQACAIESAA---MHNPNFQVFVLFAGPTYRISNNKSHP 134
            ||.|.|.||:.|         :|..:...|||||||   .|.|     |:|.....|........
 Frog    57 GNGIIFIETTDR---------MKPPSLVLCAIESAARVYRHRP-----VVFFMEGLRDITAIRDT 107

  Fly   135 QPLLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGRLSRSKYLFSHI-SDFLRYLTLYRYGGLY 198
            ...|..:.|:.||||..|.:|...:|||:..|.:.....|.:| ::|: ||..|...::|:||:|
 Frog   108 LKRLPTLSSFHNVHLFPLQMERLLNGTPLGPWYEKVNPERERY-WTHVSSDGCRLALIWRHGGIY 171

  Fly   199 LDMDVVVLRNMEKVPPNYTGAESNTHLAAGVMNLAATGFGHEIAASCLRDFQHNFNGGDWGNNGP 263
            :|.|.:.:|.:..|  |:..|:|:...:.|:..|...   |..|...:..|..|:.|..||:.||
 Frog   172 MDSDFISMRPIPDV--NFLAAKSSGVSSNGIFGLTPQ---HTFAWKGMESFVQNYRGAKWGHQGP 231

  Fly   264 GVITRVAQKIC------GTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEETIA 322
            .:.|||.::.|      .|:|:        :|..........||.:|:..||.::|   :.:.:.
 Frog   232 KLFTRVLKQYCIAPRFQSTEDV--------KCGNISFLNVKRFYPIPYPSWRRYYE---VWQNVP 285

  Fly   323 RCKDSYVVHVWNKHSSKLPIKIGSKNA-----YALYAEQNCPRSYKA 364
            :..|||.:|:||..:.:..:.:...|.     |.||    ||..|.|
 Frog   286 KFNDSYALHLWNFMNKEQKMMVPGNNTLVEHLYQLY----CPTLYGA 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 39/121 (32%)
Gb3_synth 239..365 CDD:282437 36/137 (26%)
LOC101733668XP_004915066.1 Gly_transf_sug 72..186 CDD:388717 38/121 (31%)
Gb3_synth 207..329 CDD:368001 36/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 1 1.100 - - O PTHR12042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.