DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC100497665

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_002941968.1 Gene:LOC100497665 / 100497665 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:376 Identity:107/376 - (28%)
Similarity:167/376 - (44%) Gaps:66/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VARRMFIILVLMVIGGLFYIYTSEN-----KYHSCFMEGQVLATQQALTADGETNL-LGDVLQAD 67
            :|.::.|..:|:.:..:.::|....     ||...|..              .||. |.|||   
 Frog     1 MATKVNIFAILLCLALIVFVYEINETETVVKYIPFFFY--------------PTNFTLDDVL--- 48

  Fly    68 PKPSPGNSIFFHETSCRLSENRQLETLKVTARQACAIESAAMHNPNFQVFVLFAG-PTYRISNNK 131
               ||||.|||.||:.|:..         .:...||:||||..||:..|.....| |....:..:
 Frog    49 ---SPGNGIFFIETTDRMDP---------PSLVLCAVESAARINPDRPVAFFMKGLPDINSAEGQ 101

  Fly   132 SHPQPLLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGRLSRSKYL-FSHI-SDFLRYLTLYRY 194
            :..:.....:..|:|::...|.:|...|.||:..|.:  :::..|.: ::|: ||..|...:|:|
 Frog   102 NRARNSFPTLAPYNNIYFFPLRMELLLSDTPLLPWYQ--KVNPEKEVHWTHVSSDASRLALMYKY 164

  Fly   195 GGLYLDMDVVVLRNMEKVP-PNYTGAESNTHLAAGVMNLAATGFG--HEIAASCLRDFQHNFNGG 256
            ||||:|:||:.||   .|| .|:..|||:...:.||.     ||.  .:...:|:.||..|:||.
 Frog   165 GGLYMDIDVISLR---PVPVENFLVAESSQISSNGVF-----GFDSHRDFTWTCMEDFVKNYNGA 221

  Fly   257 DWGNNGPGVITRV-AQKICGTKDIALMREDPK-RCMGFKVFGRGAFYAVPWKQWRDFFEPENLEE 319
            ..|:.||.:.||| .|..|   ||...:.|.. :|..........||.:.|.::.|.:      :
 Frog   222 IRGHQGPALFTRVFKQFYC---DIPPFKGDEDLKCGNISFLNPRRFYPIDWMKFFDIW------K 277

  Fly   320 TIARCKDSYVVHVWNK-HSSKLPIKIGSKNAYA--LYAEQNCPRSYKAAGE 367
            .|.....||.:|::|. |..|..:.:...|...  ||. ||||.:|:|..|
 Frog   278 AIPAFNKSYALHLFNSAHRYKRRVMVPGSNTLVEHLYI-QNCPLTYQAVLE 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 38/121 (31%)
Gb3_synth 239..365 CDD:282437 37/130 (28%)
LOC100497665XP_002941968.1 Gly_transf_sug 66..178 CDD:388717 35/116 (30%)
Gb3_synth 206..325 CDD:368001 37/128 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D503304at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.