DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC100494225

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_031758978.1 Gene:LOC100494225 / 100494225 -ID:- Length:341 Species:Xenopus tropicalis


Alignment Length:294 Identity:84/294 - (28%)
Similarity:128/294 - (43%) Gaps:22/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GNSIFFHETSCRLSENRQLETLKVTARQACAIESAAMHNPNFQVFVLFAGPT-YRISNNKSHPQP 136
            ||.|.|.||:.|         ::..:...|||||||...|:..|.....|.| .....::...:.
 Frog    54 GNGIIFLETTDR---------MEPPSLVLCAIESAARVYPDRPVVFFMKGLTDINTEEDEKQAKK 109

  Fly   137 LLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGRLSRSKYLFSHISDFLRYLTLYRYGGLYLDM 201
            ...::.|..||::..|.:|.....||:.:|..........|...::||..|...::||||.|.|.
 Frog   110 RFPSLSSLQNVYIFPLKMEELFKDTPLLKWFLKADPKHETYWIHNLSDGCRMAMMWRYGGFYFDS 174

  Fly   202 DVVVLRNMEKVPPNYTGAESNTHLAAGVMNLAATGFGHEIAASCLRDFQHNFNGGDWGNNGPGVI 266
            ||:.:|.:.::  |:..||.:....:.|..|..   .|..|.:.|.||..|:||..|||.||.:.
 Frog   175 DVISMRPIPEI--NFLTAEHDQTSGSSVFGLTP---HHSFAWTSLNDFVQNYNGDAWGNQGPTLF 234

  Fly   267 TRVAQKICGTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEETIARCKDSYVVH 331
            |||.::.|...  |....|...|...........|.:|:..|:.:||..:...|.   .:||.:|
 Frog   235 TRVLKQSCELS--AFKSLDNIVCGNISFLHPERIYPIPYGGWKRYFEVWDKTPTF---DNSYALH 294

  Fly   332 VWNKHSS--KLPIKIGSKNAYALYAEQNCPRSYK 363
            :||..:|  |..:.|||........:|.||..|:
 Frog   295 LWNYMNSVEKKTVVIGSNTLVENLYKQYCPSIYE 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 33/118 (28%)
Gb3_synth 239..365 CDD:282437 40/127 (31%)
LOC100494225XP_031758978.1 Gly_transf_sug 69..186 CDD:418730 32/118 (27%)
Gb3_synth 207..330 CDD:398326 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.