DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC100493718

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_031758609.1 Gene:LOC100493718 / 100493718 -ID:- Length:201 Species:Xenopus tropicalis


Alignment Length:100 Identity:29/100 - (28%)
Similarity:42/100 - (42%) Gaps:10/100 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GNSIFFHETSCRLSENRQLETLKVTARQACAIESAAMHNPNFQVFVLFAGPT-YRISNNKSHPQP 136
            |:.|.|.||:         .:|:.::...|||||||....|..|.....|.| ......:|..:.
 Frog   101 GDGIIFLETT---------NSLRPSSLVLCAIESAAHVYHNRPVVFFMKGLTDITTMEEESQIRN 156

  Fly   137 LLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGR 171
            ....:.:|.||::..|.||.....||:..|.|..|
 Frog   157 TFPTLATYKNVYIFPLRLEEIFEDTPLLPWYKKFR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 22/73 (30%)
Gb3_synth 239..365 CDD:282437
LOC100493718XP_031758609.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.