DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC100493555

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_031758833.1 Gene:LOC100493555 / 100493555 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:307 Identity:81/307 - (26%)
Similarity:137/307 - (44%) Gaps:31/307 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 DVLQADPKPSPGNSIFFHETSCRLSENRQLETLKVTARQACAIESAA-MHNPNFQVFVLFAGPTY 125
            |||:      .||.|.|.||:.|         :|..:...||||||| ::.....||.:......
 Frog    46 DVLK------EGNGIIFVETTDR---------MKPPSLVLCAIESAARVYKDRPVVFFMKGLQDI 95

  Fly   126 RISNNKSHPQPLLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGRLSRSKYLFSHIS-DFLRYL 189
            .|..::...:.....:.|:.||:...|.::...:.||:..|.|... .:.:..::|:| |..|..
 Frog    96 TIIQDELEARQRFPTLSSFDNVYFFPLQMDKLFNDTPLMPWYKKVN-PKFEIYWTHVSADGCRLA 159

  Fly   190 TLYRYGGLYLDMDVVVLRNMEKVPPNYTGAESNTHLAAGVMNLAATGFGHEIAASCLRDFQHNFN 254
            .::::||:|:|.|::.:|.:..|  |:..||.:...:.||..|:   ..|..:...:.:|..|:|
 Frog   160 LVWKHGGIYMDSDIISMRPIPDV--NFLAAEYSQSSSNGVFGLS---HHHNFSWKSMENFVQNYN 219

  Fly   255 GGDWGNNGPGVITRVAQKICGTKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEE 319
            |..|||.||.:.||..:..|...... ..||.| |..........||.:|:..|:.:::   :..
 Frog   220 GAIWGNQGPQLFTRTLKTFCTIPQFK-SNEDVK-CGNISFLNPKRFYPIPYGAWKRYYD---VCP 279

  Fly   320 TIARCKDSYVVHVWNKHSSKLPIKIGSKNAYA--LYAEQNCPRSYKA 364
            .:....|||.:|.||..:.:....:...|...  || :|.||.:|.|
 Frog   280 NVPTFNDSYALHFWNFMNKEQKTMVPGDNTLIEHLY-KQYCPTTYAA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 30/119 (25%)
Gb3_synth 239..365 CDD:282437 35/128 (27%)
LOC100493555XP_031758833.1 Gly_transf_sug 66..183 CDD:418730 29/119 (24%)
Gb3_synth 204..326 CDD:398326 35/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.