DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC100492379

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_002935110.1 Gene:LOC100492379 / 100492379 -ID:- Length:345 Species:Xenopus tropicalis


Alignment Length:349 Identity:92/349 - (26%)
Similarity:152/349 - (43%) Gaps:41/349 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 MVIGGLFYIYTSEN--KYHSCFMEGQVLATQQALTADGETNLLGDVLQADPKPSPGNSIFFHETS 82
            |::|.::...|:::  .|...::...::.|..     ...|:|.:          ||.|.|.||:
 Frog    18 MILGFIYRAATNKSTVPYILSYISDPIIYTSM-----NPENILKE----------GNGIIFLETT 67

  Fly    83 CRLSENRQLETLKVTARQACAIESAAMHNPNFQVFVLFAGPT-YRISNNKSHPQPLLEAILSYSN 146
            .|         ::..:...|||||||...|:..|.....|.| ....:::...:....::.|:.|
 Frog    68 DR---------MEPPSLVLCAIESAARVYPDRPVVFFMKGLTDINSEDDEKRAKERFPSLSSFEN 123

  Fly   147 VHLRRLNLESYASGTPMEEWLKDGRLSRSKYLFSHISDFLRYLTLYRYGGLYLDMDVVVLRNMEK 211
            |::..|.:|...:.||:..|.......|.:|...::||..|...::||||.|.|.||:   :|..
 Frog   124 VYIFPLRMEKLFNNTPLLMWYLKADPKRERYWIHNLSDGCRMAMMWRYGGFYFDADVI---SMRP 185

  Fly   212 VP-PNYTGAESNTHLAAGVMNLAATGFGHEIAASCLRDFQHNFNGGDWGNNGPGVITRVAQKICG 275
            :| .|:..||:.....:.|..|:.   .:..|.:.|.||..|:||..|||.||.:.|||.::.|.
 Frog   186 IPEKNFLTAENQHTSGSSVFGLSP---HNSFAWTSLNDFVQNYNGDAWGNQGPTLFTRVLKQSCE 247

  Fly   276 TKDIALMREDPKRCMGFKVFGRGAFYAVPWKQWRDFFEPENLEETIARCKDSYVVHVWNKHSS-- 338
            ..  |....|...|...........|.:|:..|:.:||   :.:.|....:||.:|:||..:|  
 Frog   248 LS--AFKSLDNIVCGNISFLHPERIYPIPYGGWKRYFE---VWDKIPTFDNSYALHLWNYMNSGE 307

  Fly   339 KLPIKIGSKNAYALYAEQNCPRSY 362
            |..:.|||........:|.||..|
 Frog   308 KKTVVIGSNTLVENLYKQYCPSIY 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 35/119 (29%)
Gb3_synth 239..365 CDD:282437 39/126 (31%)
LOC100492379XP_002935110.1 Gly_transf_sug 73..188 CDD:418730 33/117 (28%)
Gb3_synth 213..334 CDD:398326 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.