DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alpha4GT1 and LOC100490508

DIOPT Version :9

Sequence 1:NP_608737.1 Gene:alpha4GT1 / 33512 FlyBaseID:FBgn0031491 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_002941274.1 Gene:LOC100490508 / 100490508 -ID:- Length:336 Species:Xenopus tropicalis


Alignment Length:323 Identity:89/323 - (27%)
Similarity:139/323 - (43%) Gaps:59/323 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ADPKPSP---------GNSIFFHETSCRLSENRQLETLKVTARQACAIESAA---MHNPNFQVFV 118
            |.|..||         ||.|.|.||:         :.:|..:...|||||||   .|.|     |
 Frog    40 APPSFSPISPADVLRDGNGIIFIETT---------DKMKPPSLVLCAIESAARVYRHRP-----V 90

  Fly   119 LFAGPTYRISNNKSHPQPLLEAILSYSNVHLRRLNLESYASGTPMEEWLKDGRLSRSKYLFSHI- 182
            :|.....|...........|..:.|:.||||..|.:|....|||:..|.:.....|..| ::|: 
 Frog    91 VFFMEGLRDITAMRDALKRLPTLSSFHNVHLFPLQMERLFHGTPLGPWYEKVNPEREIY-WTHVS 154

  Fly   183 SDFLRYLTLYRYGGLYLDMDVVVLRNMEKVPPNYTGAESNTHLAAGVMNLAATGFGHEIAASCLR 247
            ||..|...::|:||:|:|.|.:.:|.:..|  |:..|:|:...:.|:..|...   :..|...:.
 Frog   155 SDGCRLALIWRHGGIYMDSDFISMRPIPDV--NFLAAQSSDVSSNGIFGLTPQ---NTFAWKGME 214

  Fly   248 DFQHNFNGGDWGNNGPGVITRVAQKIC------GTKDIALMREDPKRCMGFKVFGRGAFYAVPWK 306
            .|..|:.|.:||:.||.:.|||.::.|      .|:|:        :|..........||.:|:.
 Frog   215 SFVQNYRGAEWGHQGPQLFTRVLKQYCITLRFQSTEDV--------KCGDISFLNEMRFYPIPYP 271

  Fly   307 QWRDFFEPENLEETIARCKDSYVVHVWNKHSSKLPIKIGSKNA-----YALYAEQNCPRSYKA 364
            .||.::|   :.:.:.:..|||.:|:||..:.:....:...|.     |.||    ||..|.|
 Frog   272 SWRRYYE---VWQNVPKFNDSYALHLWNFMNKEQETMVPGSNTLVEHLYQLY----CPTLYGA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alpha4GT1NP_608737.1 Gly_transf_sug 99..217 CDD:282357 39/121 (32%)
Gb3_synth 239..365 CDD:282437 35/137 (26%)
LOC100490508XP_002941274.1 Gly_transf_sug 71..185 CDD:303104 38/121 (31%)
Gb3_synth 208..328 CDD:282437 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9755
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4577
OMA 1 1.010 - - QHG47281
OrthoDB 1 1.010 - - D1082380at2759
OrthoFinder 1 1.000 - - FOG0000423
OrthoInspector 1 1.000 - - mtm9340
Panther 1 1.100 - - O PTHR12042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X281
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.