DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc85 and ccdc85b

DIOPT Version :9

Sequence 1:NP_608734.2 Gene:Ccdc85 / 33509 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001165771.1 Gene:ccdc85b / 779472 XenbaseID:XB-GENE-5772343 Length:201 Species:Xenopus tropicalis


Alignment Length:144 Identity:70/144 - (48%)
Similarity:94/144 - (65%) Gaps:14/144 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 GRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTAS 347
            |||..|.|||||..:.|:|.||:.|.||.::|:||:||||||||||.|.:|||.|||.||.:.|.
 Frog    47 GRLIKEVNRQLQGHLTEIRELKQVNHRLQEENRELKDLCCFLDDDRLKSKKLASEWQLFGYHAAK 111

  Fly   348 VMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEE----RAH---VAANAL-CAGCGAAT 404
            |:|:::..|..||.:|:.:|:||:.:|..|.|:.|.|:|:    |.|   |||:.| ...||.  
 Frog   112 VLREDLGGYLKKLSELERRQEELMRENSCLSEVFLALEEDSGPIRHHASPVAASELSLLPCGP-- 174

  Fly   405 RNALRDDGDGSSSS 418
                ||.||||||:
 Frog   175 ----RDLGDGSSST 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc85NP_608734.2 DUF2216 <283..389 CDD:287229 54/109 (50%)
ccdc85bNP_001165771.1 CCDC85 9..177 CDD:402021 63/135 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4244
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393196at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.