DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc85 and CCDC85B

DIOPT Version :9

Sequence 1:NP_608734.2 Gene:Ccdc85 / 33509 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_006839.2 Gene:CCDC85B / 11007 HGNCID:24926 Length:202 Species:Homo sapiens


Alignment Length:143 Identity:67/143 - (46%)
Similarity:90/143 - (62%) Gaps:7/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 GRLTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTAS 347
            |||..|.|||||..:.|:|.||:.|:||..:|:||||||||||.:||:||:.||:||.||...:.
Human    43 GRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASR 107

  Fly   348 VMRQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAANALCAGCGAATRNAL---- 408
            .:|:::.....||.:|:.:|:||:.:||.||||||.|.||.......:...|.||.....|    
Human   108 AVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPP 172

  Fly   409 ---RDDGDGSSSS 418
               ||.||||||:
Human   173 CGPRDLGDGSSST 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc85NP_608734.2 DUF2216 <283..389 CDD:287229 55/105 (52%)
CCDC85BNP_006839.2 DUF2216 5..178 CDD:287229 60/134 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 148..202 12/38 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4285
eggNOG 1 0.900 - - E1_KOG3819
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393196at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13546
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3355
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.