DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc85 and ccdc85a

DIOPT Version :9

Sequence 1:NP_608734.2 Gene:Ccdc85 / 33509 FlyBaseID:FBgn0031488 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_002936874.2 Gene:ccdc85a / 100496271 XenbaseID:XB-GENE-954470 Length:380 Species:Xenopus tropicalis


Alignment Length:351 Identity:112/351 - (31%)
Similarity:164/351 - (46%) Gaps:72/351 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 LTAEQNRQLQSLVNELRALKEQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVM 349
            |..|.||:||..:.|:|.||:.||:|.:|||||||||||||||||||:|::|||||.||||:.:|
 Frog    50 LIREVNRRLQLHLGEIRGLKDVNQKLQEDNQELRDLCCFLDDDRQKGKKISREWQRLGRYTSGIM 114

  Fly   350 RQEVAAYQNKLRQLDDKQQELITDNLELKELCLYLDEERAHVAAN--------ALCAGCGAATRN 406
            ::||..|..||:.|:.:|:|::.:|:||||:|..||||:...|.:        :|| ........
 Frog   115 QKEVTLYLQKLKDLEVRQEEMVKENVELKEICFLLDEEKTGGAGSRSSIDSQTSLC-HLNTTAST 178

  Fly   407 ALRDDGDGSS---------------SSTNADETITALRNYAEQRQLPQDLRHAHTLNDQTLQYVR 456
            .|||.|||||               :|||:.|.:...|....    |:..:|.:...|. ||..|
 Frog   179 FLRDVGDGSSTSSAGSTDSPDHHKPNSTNSPEHLQKNRGEGS----PEHQKHGNGSPDH-LQKNR 238

  Fly   457 SLERRIQQLEEERTTPTAH---------LQQPTTPTPQATPTPTVTSAATPAK------------ 500
            |......|...:.::|..|         .|:.|..:|:......::|:....|            
 Frog   239 SSASPDHQKHVKSSSPEHHKSVGKSSPEQQKHTCSSPENLQKQMLSSSPELFKKHRSGGSPEYQK 303

  Fly   501 -SAASPHQQQQQ----QQQHQQQQQDIVAAAAAAAAAIQLPEPIAGRPEAVVRALQVLEVREQLE 560
             |:|||...|:.    ..:|.|:        |..::...|.....|.||    .|::|.     .
 Frog   304 LSSASPEHLQKHTLSGNSEHLQK--------ARGSSPEHLRPHFGGSPE----HLKLLS-----G 351

  Fly   561 RDRLGNLAGSALDQMDDGEKALVREM 586
            ..|.|.|.....|:|....:::...|
 Frog   352 SSREGTLRRQVADEMSAHHRSVYNGM 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc85NP_608734.2 DUF2216 <283..389 CDD:287229 61/103 (59%)
ccdc85aXP_002936874.2 CCDC85 10..183 CDD:370898 66/133 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4244
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3539
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393196at2759
OrthoFinder 1 1.000 - - FOG0002221
OrthoInspector 1 1.000 - - otm49474
Panther 1 1.100 - - O PTHR13546
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1655
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.