DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment okr and CG6985

DIOPT Version :9

Sequence 1:NP_476661.1 Gene:okr / 33507 FlyBaseID:FBgn0002989 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_651091.1 Gene:CG6985 / 42694 FlyBaseID:FBgn0039017 Length:501 Species:Drosophila melanogaster


Alignment Length:447 Identity:84/447 - (18%)
Similarity:142/447 - (31%) Gaps:173/447 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 GQNTDSTEQERQRAIEKT------------QELIGLVDQCIIRR--------------------- 396
            |:..|:....:||.:::.            ||.|..|::|:|:|                     
  Fly    95 GKVVDTMTYFKQRQLQENDQLEVGSKDVEIQEEIKTVEECLIQRQLEIANWCQKIDAQNGCTDTS 159

  Fly   397 ---------TNQILTK-------YLPVKFEM-----------VICAKLTAIQLELY-TNFLKSDQ 433
                     .:.:|.|       :.|...|:           ......|::..::| .|.||.:.
  Fly   160 PPPADSAPVRSHLLKKIKREADAFAPPHLEISQHREDKHVSYAAADSSTSMGKKIYEQNTLKIEN 224

  Fly   434 VRRSL-----------ADCNEKASL-------TALADITTLKKI----CSHPDLIYEKLTAREKG 476
            ..:..           |:..:|..|       |:..:.:|||:|    |.||.|:  |.......
  Fly   225 PTKEFTQSEYLCLLTPAELQKKILLFVSEYAQTSKTESSTLKEIFQIVCDHPVLL--KTLGTNPV 287

  Fly   477 FENSQNVLPSNYKPKDLNPEL----SGKFMLLDFMLAAIRAEGNDKVVLISNYTQTLDLFEQLAR 537
            |:....||.:...|.   |.:    |.||..|..||..:.||..:|..:::|....|.|.....:
  Fly   288 FKEIMEVLDAILPPW---PSMGLYDSAKFEFLHVMLDHLVAERGEKCCILANSEDCLTLVRGYCQ 349

  Fly   538 KRKYGFVRLDGTMSIKKRSKVVDRFN---DPESDSFLFMLSSKAGGCGLNLIGANRLFMFDPDWN 599
            .......:|||...       |:.||   |.|....|.:.|..:   .|..:....|.::    |
  Fly   350 SYSLDHAQLDGPQK-------VNLFNSLADGEPMIGLILTSDLS---ALRALRCKHLIIY----N 400

  Fly   600 PANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSSTIIDNNESAEK-----HF 659
            ..:.:||               .:|:|.|:::.||.           |:|....|.|:     |.
  Fly   401 HNSRQQA---------------NQLLAVGAMDTKIY-----------TLITAGGSPEELQFYGHM 439

  Fly   660 TRDDLKDL---------------------------FTFDANILSDTHDKLKCKRCVQ 689
            ..|.::||                           ..|:...:||:.|      |:|
  Fly   440 GDDSIEDLQNCRSQLIPTASNNLADWTKSEPPFDRVFFEETAISDSLD------CIQ 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
okrNP_476661.1 SNF2_N 159..466 CDD:278600 31/183 (17%)
DEXDc 179..328 CDD:238005
HELICc 493..622 CDD:238034 28/135 (21%)
CG6985NP_651091.1 DUF2439 60..128 CDD:287368 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0390
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.