DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment okr and CG7376

DIOPT Version :9

Sequence 1:NP_476661.1 Gene:okr / 33507 FlyBaseID:FBgn0002989 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001261471.1 Gene:CG7376 / 38715 FlyBaseID:FBgn0035689 Length:1270 Species:Drosophila melanogaster


Alignment Length:336 Identity:76/336 - (22%)
Similarity:131/336 - (38%) Gaps:86/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 TDSTEQERQRAIEKTQELIGLVDQCIIRRTNQILTKYLPVKFEMVICAKLTAIQLELYTNFLKSD 432
            ||..|::....|...|     :|:.:  :.||...:...:.|.. :|.:|.      |...||.|
  Fly   981 TDDPEEQSNYRILACQ-----LDEQL--QFNQYNLQTSQLNFTR-LCGRLK------YLKHLKED 1031

  Fly   433 QVRRSLADCNEKASLTALADITTLKKICSH-----------------------------PDLIYE 468
            ...:....|..:      .|:..:..:|.|                             |.|.| 
  Fly  1032 SADKPCPICQTQ------DDVRYVMMVCGHFVCQHCLDSMRRKNGRAGVTKCPLCRQDSPQLYY- 1089

  Fly   469 KLTAREKGFENSQNVLPSNYKPKDLNPELSGKFMLLDFMLAAIRAEGNDKVVLISNYTQTLDLFE 533
                         :|.|..:  |.:..:.|.|...:..::..|:.|...:.:::  ::|...:..
  Fly  1090 -------------SVRPGAH--KSIIGDFSTKISSVVELVLKIKGENEQEKIIV--FSQWQAILI 1137

  Fly   534 QLARKRKYGFVRLDGTMSIKK-RSKVVDRFNDPESDSFLFMLSSKAGGCGLNLIGANRLFMFDPD 597
            ::||.     :.|:|.....| .:|..|.|.:|.|:....::....|..|||||.|..:|:.:|.
  Fly  1138 EIARA-----LSLNGIQFRNKCTNKDFDDFKNPLSNVTCLLMPLSKGSKGLNLIEATHVFLVEPI 1197

  Fly   598 WNPANDEQAMARVWRDGQKKPCYIYRLVASGSIEEKILQRQTHKKSLSSTIIDNNESAEKHF--- 659
            .||.::.||:.|:.|.|||:|..::|.:.:.:|||.||       || .|..|:..:...|:   
  Fly  1198 LNPGDERQAIGRIHRFGQKRPTKVHRFIVNETIEENIL-------SL-ITSADDTTTLSTHWDLE 1254

  Fly   660 --TRDDLKDLF 668
              |.|.||.||
  Fly  1255 NMTLDSLKKLF 1265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
okrNP_476661.1 SNF2_N 159..466 CDD:278600 20/126 (16%)
DEXDc 179..328 CDD:238005
HELICc 493..622 CDD:238034 34/129 (26%)
CG7376NP_001261471.1 SNF2_N 221..601 CDD:278600
PHD_SF 281..320 CDD:304600
TPR 636..669 CDD:197478
RING 1037..1083 CDD:238093 4/51 (8%)
HepA <1096..1238 CDD:223627 43/158 (27%)
Helicase_C 1108..1214 CDD:278689 28/112 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.