DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment okr and Fsbp

DIOPT Version :9

Sequence 1:NP_476661.1 Gene:okr / 33507 FlyBaseID:FBgn0002989 Length:784 Species:Drosophila melanogaster
Sequence 2:XP_006237955.1 Gene:Fsbp / 102550523 RGDID:7611658 Length:298 Species:Rattus norvegicus


Alignment Length:226 Identity:46/226 - (20%)
Similarity:91/226 - (40%) Gaps:32/226 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AYTEHERMGMDPTKVLVHVVVDPLLSNILRPHQREGVRFMYECVEGKRGNFNGCIMADEMGLGKT 192
            |.::::....:|||.:|.::  |.:|:......|..::........:.|..:..:|.|...:..|
  Rat    89 AQSDYKSSISEPTKKVVEMI--PQISSFCLVRDRNHIQSTNLDEAAQAGTSSLQVMVDHHPVAIT 151

  Fly   193 LQCVTLVWTLLRQGPECKPTINKAIVVSP---SSLVKNWEKEFTKWLHG----RLLCLPMEGGTK 250
            ::        ::|..:.||  :.|:|.||   .:|.:..|.|..:...|    .|..:.|...:.
  Rat   152 VE--------VKQEEDIKP--SPALVSSPQHNDALEQQEEHELMRVAEGSVSPSLSSVDMRMTSS 206

  Fly   251 ENTIRALEQFSMTSA-------RLGTPVLLISYETFRIYAEILCKYEVGMVICDEGHRLKNSDNL 308
            .:::...:.|...|.       |....||.:..|..::..|...|:  |:.:.::...||....|
  Rat   207 PSSVPRRDVFHQESGEHLRSLLRCDPQVLQMLKEEHQLILENQKKF--GLYVQEKRDGLKRRQRL 269

  Fly   309 TYQALMGLKTKRRV-LLSGTPIQNDLTEYYS 338
            ..:.   |:.|..| .|..:.::.||.||.|
  Rat   270 EEEL---LRAKIEVEKLRASRLRRDLPEYSS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
okrNP_476661.1 SNF2_N 159..466 CDD:278600 39/195 (20%)
DEXDc 179..328 CDD:238005 32/163 (20%)
HELICc 493..622 CDD:238034
FsbpXP_006237955.1 Myb_DNA-bind_5 6..82 CDD:290584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001533
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.