DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd1 and 1700125H20Rik

DIOPT Version :9

Sequence 1:NP_001245851.1 Gene:Chd1 / 33505 FlyBaseID:FBgn0250786 Length:1900 Species:Drosophila melanogaster
Sequence 2:XP_006534402.1 Gene:1700125H20Rik / 73634 MGIID:1920884 Length:277 Species:Mus musculus


Alignment Length:87 Identity:33/87 - (37%)
Similarity:55/87 - (63%) Gaps:2/87 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly  1526 IFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCLLQIGKQIDVCLNPYAET-EKKEWRSN 1589
            :.::|||.:||:||.|:.|:.|. .|..:.::::|:..|..:|..|:..|..|... |.|.|:..
Mouse    78 VTSQCKEYLRPLKKFLRKLNLPK-DLPQKKRIKYTKQSLEALGGHINTFLQHYCRAWEIKHWKKM 141

  Fly  1590 LWYFVSKFTELDAKRLFKIYKH 1611
            ||.|||.|:||:||:|.::||:
Mouse   142 LWRFVSLFSELEAKQLRRLYKY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd1NP_001245851.1 CHROMO 374..422 CDD:237991
Chromo 458..509 CDD:278797
SNF2_N 548..829 CDD:278600
DEXDc 564..709 CDD:238005
Helicase_C 852..967 CDD:278689
DUF4208 1521..1610 CDD:290618 31/84 (37%)
DUF3824 1795..>1894 CDD:289625
1700125H20RikXP_006534402.1 DUF4208 81..162 CDD:372803 31/81 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.