DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Chd1 and C17orf64

DIOPT Version :9

Sequence 1:NP_001245851.1 Gene:Chd1 / 33505 FlyBaseID:FBgn0250786 Length:1900 Species:Drosophila melanogaster
Sequence 2:XP_005257090.1 Gene:C17orf64 / 124773 HGNCID:26990 Length:279 Species:Homo sapiens


Alignment Length:351 Identity:83/351 - (23%)
Similarity:124/351 - (35%) Gaps:99/351 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1443 GEDAAGDART----VAESSNSQVDPSTASPHNAPATEQHGDPAKKAKKSKARSKKTSASDNNGNK 1503
            |...||:||.    .|.|.....:.:|.|          ||...:|::::.:....|..:     
Human     9 GRWVAGEARADGGPTALSRRQAKNRATLS----------GDNWARAQRTRRKVTNVSCLE----- 58

  Fly  1504 PMHFTANNEPRALEVL----GDLDPSIFNECKEKMRPVKKALKALDQPDVSLSDQDQLQHTRDCL 1564
                |:::...|.:.|    ..||...|..|||.:||:||.|:.|..|. .|..:.:|::.:..|
Human    59 ----TSSSASPARDSLMRHAKGLDQDTFKTCKEYLRPLKKFLRKLHLPR-DLPQKKKLKYMKQSL 118

  Fly  1565 LQIGKQIDVCLNPYAET-EKKEWRSNLWYFVSKFTELDAKRLFKIYKHALKQKAGGDGEAKGKDK 1628
            :.:|..|:..|..|.:. |.|.||..||.|:|.|:||:||:|.::||:.                
Human   119 VVLGDHINTFLQHYCQAWEIKHWRKMLWRFISLFSELEAKQLRRLYKYT---------------- 167

  Fly  1629 GSSGSPAKSKPNGVTTEEKEKERD--RSGGKKKKKDKDKERSGQARYPETGIPTSGRYADPPLKR 1691
             .|..|||......|......|.|  |.|                                    
Human   168 -KSSQPAKFLVRRKTFRPSTAEGDILRLG------------------------------------ 195

  Fly  1692 KRDENDADASSGLAGAPGGGIGDNLKSMSFKRLNMDRHEDRKKHH-----RGPDYYGGSGP-PMG 1750
                   .|...|||.||......|..|...:.: .|||.....|     |.|..:....| |..
Human   196 -------CAGEVLAGRPGRQSAQALPCMGAAQQH-QRHEGAAVQHADPRSREPPAWAAKIPGPCQ 252

  Fly  1751 SGSYEGG-SNSRRQGPTSPSTPRTGR 1775
            ...::|. |.::.|......:||..|
Human   253 ERFFKGAFSKTKTQEEEDKGSPRNSR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Chd1NP_001245851.1 CHROMO 374..422 CDD:237991
Chromo 458..509 CDD:278797
SNF2_N 548..829 CDD:278600
DEXDc 564..709 CDD:238005
Helicase_C 852..967 CDD:278689
DUF4208 1521..1610 CDD:290618 34/89 (38%)
DUF3824 1795..>1894 CDD:289625
C17orf64XP_005257090.1 DUF4208 85..165 CDD:290618 31/80 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0384
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.