DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and EFM4

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_012200.1 Gene:EFM4 / 854746 SGDID:S000001326 Length:257 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:89/228 - (39%)
Similarity:137/228 - (60%) Gaps:17/228 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SELNGSELGTKEFWESSYNREIRNYKSH-GDVGEIWF-DESAQWRTIDWLLNE---EKIDKEASR 62
            ::|:.|:||||::|:..|..|:.|::.: .|.|:.|| |..|:.:.||:|::.   .:|.:.|| 
Yeast    33 ADLSTSKLGTKKYWDELYALELENFRRNPQDTGDCWFSDSDAEQKMIDFLVDNIGAYRISENAS- 96

  Fly    63 VLDLGCGNGMFLVGLANEGFTGDLTGVDYSPKAVELAQNIAE----DNKLSITYKVADLTQPQNE 123
            |:|||.|||..|..|....|.|.|.|:|||.::|:||.||||    ||  .|:::.||:.....:
Yeast    97 VVDLGTGNGHMLFELHQTEFQGKLVGIDYSEESVKLASNIAEATGVDN--FISFQQADIFSGDWK 159

  Fly   124 LGQFDVVHDKGTYDAVSLCPDNAKEKR---ALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFA 185
            .|::|:|.||||.||:||.......|.   .:|...||::|: .|.:|:|||||:|:||||....
Yeast   160 PGKYDIVLDKGTLDAISLSGMKINGKLDVVDVYAGVVERILK-KDGIFLITSCNFTQDELVKIIE 223

  Fly   186 EKFVKYY-TIPTPTFKFGGKVGNVVTSIVFKRK 217
            ...:|.: ||..|.|:|||..|..:.|:.|.::
Yeast   224 TDNLKMWKTIKYPVFQFGGVQGATICSVAFVKQ 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 50/120 (42%)
EFM4NP_012200.1 Methyltransf_31 91..242 CDD:404690 65/154 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342017
Domainoid 1 1.000 91 1.000 Domainoid score I1739
eggNOG 1 0.900 - - E1_KOG1271
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6175
Inparanoid 1 1.050 138 1.000 Inparanoid score I1192
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54713
OrthoFinder 1 1.000 - - FOG0004954
OrthoInspector 1 1.000 - - oto100362
orthoMCL 1 0.900 - - OOG6_103983
Panther 1 1.100 - - LDO PTHR12843
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2287
SonicParanoid 1 1.000 - - X3497
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.