DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and AR401

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_176841.1 Gene:AR401 / 842986 AraportID:AT1G66680 Length:358 Species:Arabidopsis thaliana


Alignment Length:280 Identity:96/280 - (34%)
Similarity:134/280 - (47%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DSELNG-SELGTKEFWESSYNREIRNYKSHGDVGEIWFDESAQWRTIDWLLN------------- 52
            |::..| |.||.:.:|:::|:.|:.|::.||..||:||.:........|..:             
plant    88 DADGGGQSMLGLQSYWDAAYSDELTNFREHGHAGEVWFGDDVMEIVTSWTKDLCVEISQRNMSVS 152

  Fly    53 --------EEKIDKEAS--RVLDLGCGNGMFLVGLANEGFTGDLTGVDYSPKAVELAQNIAE-DN 106
                    .::.||..|  .|||||.|||:.|..||.|||: ||||.|||..||||||:::: |.
plant   153 ENDVTTEVNDQADKYLSSWNVLDLGTGNGLLLHQLAKEGFS-DLTGTDYSDGAVELAQHLSQRDG 216

  Fly   107 KLSITYKVADLTQPQNELGQFDVVHDKGTYDAVSLCPDNAKEKRALYLDTVEKLLRTADSLFVIT 171
            ..:|.:.|.|:...:.| .||.:|.||||.||:.|.|| ...||.:|.|:|.||: ....:.|||
plant   217 FPNIRFMVDDILDTKLE-QQFKLVMDKGTLDAIGLHPD-GPVKRVMYWDSVSKLV-APGGILVIT 278

  Fly   172 SCNWTEDELVDSFAEKF---------------------------------------VKYYTIPTP 197
            |||.|:||||:. .|.|                                       |:.|    |
plant   279 SCNHTKDELVEE-VENFNIRKSNLCRGDGNDANNVLSSGSEAASRIDQPPFEYLSHVRTY----P 338

  Fly   198 TFKFGGKVGNVVTSIVFKRK 217
            ||.|.|.||:.|.::.|.||
plant   339 TFMFSGSVGSRVATVAFLRK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 55/116 (47%)
AR401NP_176841.1 Methyltransf_31 172..276 CDD:290559 51/107 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2422
eggNOG 1 0.900 - - E1_KOG1271
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6175
Inparanoid 1 1.050 126 1.000 Inparanoid score I1923
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422013at2759
OrthoFinder 1 1.000 - - FOG0004954
OrthoInspector 1 1.000 - - oto3575
orthoMCL 1 0.900 - - OOG6_103983
Panther 1 1.100 - - LDO PTHR12843
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.