DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and Eef1akmt2

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_082371.1 Gene:Eef1akmt2 / 72096 MGIID:1919346 Length:244 Species:Mus musculus


Alignment Length:211 Identity:102/211 - (48%)
Similarity:143/211 - (67%) Gaps:5/211 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SELGTKEFWESSYNREIRNYKSHGDVGEIWFDESAQWRTIDWLLNEEKIDKEASRVLDLGCGNGM 72
            |.|||:|.|::.|.||:|.::.:||.|||||.|.:..|.|.| :.:.||..:|| |||:|.|||:
Mouse    30 SALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRW-MQKHKIPLDAS-VLDIGTGNGV 92

  Fly    73 FLVGLANEGFTGDLTGVDYSPKAVELAQNIAEDNKLS-ITYKVADLTQPQNELGQFDVVHDKGTY 136
            |||.|...||: ::||:||||.|::|:.:|.|...|| |..||.|...|..:|..|.|..|||||
Mouse    93 FLVELVKHGFS-NITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTY 156

  Fly   137 DAVSLCPDNAKEKRALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPTFKF 201
            ||:||.||||.|||..|:.::.::|. ....|:|||||||:.||:|:|:|.|..:..:|||.|.|
Mouse   157 DAISLNPDNAIEKRKQYVMSLSRVLE-VKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSF 220

  Fly   202 GGKVGNVVTSIVFKRK 217
            ||:.||.|.::||:::
Mouse   221 GGRSGNTVAALVFQKR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 56/114 (49%)
Eef1akmt2NP_082371.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
SmtA 40..>194 CDD:223574 75/157 (48%)
Methyltransf_18 80..192 CDD:289607 56/114 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833483
Domainoid 1 1.000 123 1.000 Domainoid score I5616
eggNOG 1 0.900 - - E1_KOG1271
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6175
Inparanoid 1 1.050 197 1.000 Inparanoid score I3795
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54713
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004954
OrthoInspector 1 1.000 - - oto95345
orthoMCL 1 0.900 - - OOG6_103983
Panther 1 1.100 - - LDO PTHR12843
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2287
SonicParanoid 1 1.000 - - X3497
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.