DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and eef1akmt2

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001013345.1 Gene:eef1akmt2 / 503749 ZFINID:ZDB-GENE-050306-30 Length:233 Species:Danio rerio


Alignment Length:210 Identity:98/210 - (46%)
Similarity:140/210 - (66%) Gaps:5/210 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SELGTKEFWESSYNREIRNYKSHGDVGEIWFDESAQWRTIDWLLNEEKIDKEASRVLDLGCGNGM 72
            |:|||||:|:.:|.||::.||..||||||||.|.:..|.|.|:  |.:...|.:.:||:|.||||
Zfish    26 SKLGTKEYWDGAYKRELQTYKDIGDVGEIWFGEESMHRVIRWM--EAQNISENAAILDIGTGNGM 88

  Fly    73 FLVGLANEGFTGDLTGVDYSPKAVELAQNI-AEDNKLSITYKVADLTQPQNELGQFDVVHDKGTY 136
            |||.||..||: :|||:|||..|:||..|| .|:...:|..:|.|...|..||..|||..||||:
Zfish    89 FLVELARHGFS-NLTGIDYSKAALELTTNILVEEGLKNINIQVEDFLNPSTELKGFDVCIDKGTF 152

  Fly   137 DAVSLCPDNAKEKRALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPTFKF 201
            ||:||.|::.:|.:..|:.::..::| .:..|:|||||||:::|::.|...|.....:|||.|:|
Zfish   153 DAISLNPEDREEAKKHYVTSLRAVMR-PNGFFIITSCNWTKEQLLEIFKPGFELVRELPTPNFQF 216

  Fly   202 GGKVGNVVTSIVFKR 216
            ||..||.||::|||:
Zfish   217 GGVTGNSVTALVFKQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 51/114 (45%)
eef1akmt2NP_001013345.1 SmtA 38..>190 CDD:223574 71/155 (46%)
Methyltransf_18 75..188 CDD:289607 51/114 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576172
Domainoid 1 1.000 113 1.000 Domainoid score I6120
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6175
Inparanoid 1 1.050 193 1.000 Inparanoid score I3844
OMA 1 1.010 - - QHG54713
OrthoDB 1 1.010 - - D1422013at2759
OrthoFinder 1 1.000 - - FOG0004954
OrthoInspector 1 1.000 - - oto39776
orthoMCL 1 0.900 - - OOG6_103983
Panther 1 1.100 - - LDO PTHR12843
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2287
SonicParanoid 1 1.000 - - X3497
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.