DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and EEF1AKMT2

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_997719.2 Gene:EEF1AKMT2 / 399818 HGNCID:33787 Length:291 Species:Homo sapiens


Alignment Length:180 Identity:85/180 - (47%)
Similarity:123/180 - (68%) Gaps:5/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SELGTKEFWESSYNREIRNYKSHGDVGEIWFDESAQWRTIDWLLNEEKIDKEASRVLDLGCGNGM 72
            |.|||:|.|::.|.||::.::.:||.|||||.|.:..|.|.| :.:.||..:|| |||:|.|||:
Human    30 SALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRW-MQKHKIPLDAS-VLDIGTGNGV 92

  Fly    73 FLVGLANEGFTGDLTGVDYSPKAVELAQNIAEDNKLS-ITYKVADLTQPQNELGQFDVVHDKGTY 136
            |||.||..||: ::||:||||.|::|:.:|.|...|| |..||.|......:|..|.:..||||:
Human    93 FLVELAKFGFS-NITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTF 156

  Fly   137 DAVSLCPDNAKEKRALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAE 186
            ||:||.||||.|||..|:.::.::|: ....|:|||||||::||::.|:|
Human   157 DAISLNPDNAIEKRKQYVKSLSRVLK-VKGFFLITSCNWTKEELLNEFSE 205

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 54/114 (47%)