DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and Eef1akmt2

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001380625.1 Gene:Eef1akmt2 / 361664 RGDID:1306300 Length:244 Species:Rattus norvegicus


Alignment Length:212 Identity:98/212 - (46%)
Similarity:143/212 - (67%) Gaps:5/212 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SELGTKEFWESSYNREIRNYKSHGDVGEIWFDESAQWRTIDWLLNEEKIDKEASRVLDLGCGNGM 72
            |.|||:|.|::.|.||::.::.:|..|||||.|.:.:|.|.| :.:.||..:|| |||:|.|||:
  Rat    30 SALGTREHWDAVYERELKTFQDYGATGEIWFGEESMYRVIRW-MQKHKIPLDAS-VLDIGTGNGV 92

  Fly    73 FLVGLANEGFTGDLTGVDYSPKAVELAQNIAEDNKLS-ITYKVADLTQPQNELGQFDVVHDKGTY 136
            |||.|...||: ::||:||||.|::|:.:|.|...|| :..||.|......:|..|.|..|||||
  Rat    93 FLVELVKHGFS-NITGIDYSPSAIKLSASILEKEGLSDVNLKVEDFLNLSTKLSGFHVCVDKGTY 156

  Fly   137 DAVSLCPDNAKEKRALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPTFKF 201
            ||:||.||||.|||..|:.::.::|. ....|:|||||||:.||:|:|:|.|..:..:|||.|.|
  Rat   157 DAISLNPDNAVEKRKQYVMSLSRVLE-VKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSF 220

  Fly   202 GGKVGNVVTSIVFKRKK 218
            ||:.||.|.::||::::
  Rat   221 GGRCGNTVAALVFQKRE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 54/114 (47%)
Eef1akmt2NP_001380625.1 Methyltransf_31 80..214 CDD:404690 65/136 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H6175
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422013at2759
OrthoFinder 1 1.000 - - FOG0004954
OrthoInspector 1 1.000 - - oto98832
orthoMCL 1 0.900 - - OOG6_103983
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3497
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.