DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and SPAC977.03

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_592776.1 Gene:SPAC977.03 / 2543345 PomBaseID:SPAC977.03 Length:145 Species:Schizosaccharomyces pombe


Alignment Length:92 Identity:23/92 - (25%)
Similarity:41/92 - (44%) Gaps:8/92 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LNEEKIDKEASRVLDLGC---GNGMFLVGLANEGFTGDLTGVDYSPKAVELAQNIAEDNKLSITY 112
            :|..::.|....|||.||   .|..:|..|..:     :.|:|.|.:|:..|.:.....|.::.:
pombe     1 MNLVQLGKLHENVLDAGCEPNRNARYLASLGYK-----VVGIDISERAISKAIDKTSSEKSNVNF 60

  Fly   113 KVADLTQPQNELGQFDVVHDKGTYDAV 139
            ...|.::.....|.||.|.|.|.:.::
pombe    61 NQRDFSRLNEFKGHFDTVIDIGCFHSI 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 21/84 (25%)
SPAC977.03NP_592776.1 AdoMet_MTases 14..>87 CDD:302624 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.