DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9643 and K12D9.1

DIOPT Version :9

Sequence 1:NP_001285572.1 Gene:CG9643 / 33504 FlyBaseID:FBgn0031485 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_503823.2 Gene:K12D9.1 / 187323 WormBaseID:WBGene00019675 Length:354 Species:Caenorhabditis elegans


Alignment Length:256 Identity:63/256 - (24%)
Similarity:93/256 - (36%) Gaps:80/256 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ELNGSELGTKEFWESSYNRE-------------------------IRNYKSHGDVG---EIWFD- 39
            |:|..|    |||.|..|.|                         |..:|..|..|   .|:.| 
 Worm    70 EVNEKE----EFWISKENVEALTNTSFQLMFHTMLPTVLRPIDSLIECFKKDGPYGLDYSIYSDF 130

  Fly    40 ESAQ---------WRTIDWLLN------EEKIDKEASRVLDLGCGNGMFLVGLANEGFTGDLTGV 89
            |..|         ...|..|:.      :||::....||||:|||.|.....||.........|:
 Worm   131 EDMQAMFTKTVYEQHMISGLIPAFGNGIKEKLEDGGFRVLDVGCGEGFHSCLLAENYSKSQFVGL 195

  Fly    90 DYSPKAVELAQ-NIAEDNK--LSITYKVAD-LTQPQNELGQFDVV------HDKGTYDAVSLCPD 144
            |...||::.|: |...|..  .::.:.|.| :..|::..|.||:|      ||       .|.||
 Worm   196 DICEKAIKSAKLNKKSDGSDFQNLEFVVGDAMIMPEDWTGCFDLVAFFGSLHD-------LLRPD 253

  Fly   145 NAKEKRALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPTFKFGGKV 205
                   |.|..|.::|:.. .:.|:|..:.|.:...|  .|.|.|...:     ::||.:
 Worm   254 -------LSLLEVHRVLKPG-GMVVLTESDGTSNVFQD--REAFGKMSAL-----QYGGSM 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9643NP_001285572.1 Methyltransf_18 59..173 CDD:289607 35/123 (28%)
K12D9.1NP_503823.2 Methyltransf_31 163..>282 CDD:316372 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.