DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and REX4

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_014561.1 Gene:REX4 / 854075 SGDID:S000005440 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:47/210 - (22%)
Similarity:78/210 - (37%) Gaps:53/210 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 MEIDDTQQKETSQL---KVPNDVQEIIPELKPKQNTETCLKEPEAVVNIDWRTRNETTPNRPILK 229
            |::.....||.|:.   |:...|.|..|.   |.||.|.:||| ..|.|...||..:..::.|.|
Yeast    60 MDMVYNMNKEISKHEKDKLEGKVFEFNPN---KANTSTTIKEP-VKVGISEDTRINSNKSKEIGK 120

  Fly   230 ---------------PTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQLFSGCKCAENKRY 279
                           ...|.|:..::.......|:|...|:.|..|:|:   ..||.|       
Yeast   121 YIAMDCEFVGVGPEGKESALARISIVNYFGHVVLDEFVKPREKVVEWRT---WVSGIK------- 175

  Fly   280 PPRGVYNLESLYTRIFKIPALSAHQAEADVVMTTKLIQH---YGIDFLAFAEEQA--------IP 333
             |..:.|..:     ||    .|.:..||::....|:.|   :.::.|..:..::        :|
Yeast   176 -PEHMKNAIT-----FK----EAQKKTADILEGRILVGHALKHDLEALMLSHPKSLLRDTSRHLP 230

  Fly   334 FQQVVPLGSPVCRKK 348
            |:::...|.....||
Yeast   231 FRKLYAKGKTPSLKK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916
TREX1_2 20..173 CDD:99839 1/4 (25%)
REX4NP_014561.1 REX4_like 122..274 CDD:99847 26/144 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.