DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3165 and RNH70

DIOPT Version :9

Sequence 1:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_011792.1 Gene:RNH70 / 853193 SGDID:S000003508 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:299 Identity:61/299 - (20%)
Similarity:106/299 - (35%) Gaps:99/299 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LKKKKKEQDQD---EQQELPAAPRVLHKLNVLFQPSMVVDPEAERITGLSNYLLER-ESQLDTDA 113
            |:||||....|   .:|:|.|                            ::|.|:. ::..|||.
Yeast   176 LQKKKKITINDLVLSEQQLVA----------------------------NDYPLDSGDTNFDTDW 212

  Fly   114 AQLI-----VSFLKHLPSPVCLVAHNGW--------GFDFPILRQAFEKLNIELPQSLTCVDSLR 165
            .|.:     .|.:..|...:|| :..|.        .||..::.:...|.::.:      ||.|.
Yeast   213 VQTVDFTHGGSHIFALDCEMCL-SEQGLVLTRISLVNFDNEVIYEELVKPDVPI------VDYLT 270

  Fly   166 AFMEIDDTQQKETSQLK-----VPNDVQEIIP------------ELKPKQNTETCLKEPEAVVNI 213
            .:..|  |::|.|...|     |..|:.:||.            :||..:     ||.|..|...
Yeast   271 RYSGI--TEEKLTVGAKKTLREVQKDLLKIISRSDILIGHSLQNDLKVMK-----LKHPLVVDTA 328

  Fly   214 DWRTRNETTPNRPILKPTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQLFSGCKCAENKR 278
            .........|.:|.||........|.:::|:.|.:|:    .|...|. ::.::.:|...     
Yeast   329 IIYHHKAGDPFKPSLKYLSETFLNKSIQNGEHDSVED----ARACLEL-TKLKILNGLAF----- 383

  Fly   279 YPPRGV-YNLESLYTRIFKIPALSAHQAEADVVMTTKLI 316
                |: .|.|:|:|::        |:.|...|:...:|
Yeast   384 ----GIGINTENLFTKL--------HRFEVKTVLLNDMI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 23/118 (19%)
TREX1_2 20..173 CDD:99839 27/136 (20%)
RNH70NP_011792.1 REX1_like 226..374 CDD:99848 35/166 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.